A database of peptides from the non-coding regions of genome
| NCPEP00094 | |
|---|---|
| Name[Source] | Mitoregulin||Micropeptide regulator of beta-oxidation |
| Name[NCBI] | Mitoregulin |
| Gene Name[NCBI] | Mtln |
| GeneID[NCBI] | 67885 |
| Synonyms | Small integral membrane protein 37||MOXI |
| Length(AA) | 56 |
| AA Sequence | MADVSERTLQVSVLVAFASGVVLGWQANRLRRRYLDWRKRRLQDKLATTQKKLDLA |
| Molecular Weight | — |
| Function | metabolism |
| Peptide Function[Source] | Potentiates mitochondrial functions by modulating the assembly and stability of complexes and supercomplexes involved in FAO, the TCA cycle, and electron transport|Associates with the mitochondrial trifunctional protein, an enzyme complex that plays a critical role in fatty acid beta-oxidation |
| Identification Methods | Ribosome profiling|CRISPR/Cas9|Western blot||PhyloCSF|In vitro transcription and translation assays|Western blot|Mass spectrometry|CRISPR/Cas9 |
| Host ncRNA Type | lncRNA |
| Host ncRNA Symbol/ID[Source] | 1500011K16Rik |
| Host ncRNA Symbol[NCBI] | Mtln |
| Host ncRNA Length(NT)[NCBI] | 1112 |
| Chromosome[GRCh38] | 2 |
| Start[GRCh38] | 127791377 |
| Host Gene Summary[NCBI] | — |
| Species[Source] | Mouse |
| Predicted Pfam Domain | PF01165.20 |
| Predicted Domain Name | Ribosomal_S21 |
| Publication | Stein CS, et al. 2018 Cell Rep||Makarewich CA et al. 2018 Cell Rep |